SCOP 1.73: Domain d2glsc1: 2gls C:1-100

Lineage for d2glsc1 (2gls C:1-100)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d2glsc1: 2gls C:1-100 [37853]
   Other proteins in same PDB: d2glsa2, d2glsb2, d2glsc2, d2glsd2, d2glse2, d2glsf2, d2glsg2, d2glsh2, d2glsi2, d2glsj2, d2glsk2, d2glsl2

Details for d2glsc1

PDB Entry: 2gls, 3.5 Å

PDB Description: refined atomic model of glutamine synthetase at 3.5 angstroms resolution

PDB Compounds: (C:) glutamine synthetase

SCOP Domain Sequences for d2glsc1:

Sequence; same for both SEQRES and ATOM records:

>d2glsc1 d.15.9.1 (C:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 602]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Timeline for d2glsc1:

• d2glsc1 first appeared (with stable ids) in SCOP 1.55
  
• d2glsc1 appears in SCOP 1.71
  
• d2glsc1 appears in SCOP 1.75
  
• d2glsc1 appears in the current release, SCOPe 2.08