![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) ![]() |
![]() | Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein) |
![]() | Protein Glutamine synthetase, N-terminal domain [54370] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [54371] (4 PDB entries) |
![]() | Domain d2glsb1: 2gls B:1-100 [37852] Other proteins in same PDB: d2glsa2, d2glsb2, d2glsc2, d2glsd2, d2glse2, d2glsf2, d2glsg2, d2glsh2, d2glsi2, d2glsj2, d2glsk2, d2glsl2 |
PDB Entry: 2gls (more details), 3.5 Å
SCOP Domain Sequences for d2glsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2glsb1 d.15.9.1 (B:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium} saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi nesdmvlmpdastavidpffadstliircdilepgtlqgy
Timeline for d2glsb1: