SCOPe 2.08: Domain d6u3ne1: 6u3n E:3-129

Lineage for d6u3ne1 (6u3n E:3-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6u3ne1: 6u3n E:3-129 [378467]
   Other proteins in same PDB: d6u3na1, d6u3na2, d6u3nb1, d6u3nd2, d6u3ne2
   automated match to d3of6c1
   complexed with nag

Details for d6u3ne1

PDB Entry: 6u3n, 2.8 Å

PDB Description: ls2.8/3.15 - dq2-p.fluor-alpha1a complex

PDB Compounds: (E:) T-CELL RECEPTOR, LS2.8/3.15 beta

SCOPe Domain Sequences for d6u3ne1:

Sequence; same for both SEQRES and ATOM records:

>d6u3ne1 b.1.1.0 (E:3-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqspthliktrgqqvtlrcspisghksvswyqqvlgqgpqfifqyyekeergrgnfpd
rfsarqfpnysselnvnalllgdsalylcasslegqgaseqffgpgtrltvled

Timeline for d6u3ne1:

• d6u3ne1 first appeared in SCOPe 2.07