SCOP 1.61: Domain d1f52h1: 1f52 H:1-100

Lineage for d1f52h1 (1f52 H:1-100)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family)

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d1f52h1: 1f52 H:1-100 [37846]
   Other proteins in same PDB: d1f52a2, d1f52b2, d1f52c2, d1f52d2, d1f52e2, d1f52f2, d1f52g2, d1f52h2, d1f52i2, d1f52j2, d1f52k2, d1f52l2

Details for d1f52h1

PDB Entry: 1f52, 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp

SCOP Domain Sequences for d1f52h1:

Sequence; same for both SEQRES and ATOM records:

>d1f52h1 d.15.9.1 (H:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Timeline for d1f52h1:

• d1f52h1 first appeared (with stable ids) in SCOP 1.55
  
• d1f52h1 appears in SCOP 1.59
  
• d1f52h1 appears in SCOP 1.63
  
• d1f52h1 appears in the current release, SCOPe 2.08