Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6u3oc1: 6u3o C:1-81 [378459] Other proteins in same PDB: d6u3oa1, d6u3oa2, d6u3ob1, d6u3ob2, d6u3oc2, d6u3od2, d6u3oe2, d6u3of2, d6u3og1, d6u3og2, d6u3oh1, d6u3oh2 automated match to d5ujta1 |
PDB Entry: 6u3o (more details), 2.74 Å
SCOPe Domain Sequences for d6u3oc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6u3oc1 d.19.1.0 (C:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfal tniavlkhnlnslikrsnsta
Timeline for d6u3oc1: