Lineage for d6u3oc1 (6u3o C:1-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938826Domain d6u3oc1: 6u3o C:1-81 [378459]
    Other proteins in same PDB: d6u3oa1, d6u3oa2, d6u3ob1, d6u3ob2, d6u3oc2, d6u3od2, d6u3oe2, d6u3of2, d6u3og1, d6u3og2, d6u3oh1, d6u3oh2
    automated match to d5ujta1

Details for d6u3oc1

PDB Entry: 6u3o (more details), 2.74 Å

PDB Description: jr51 dq2-p.aeru-alpha2a complex
PDB Compounds: (C:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6u3oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u3oc1 d.19.1.0 (C:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfal
tniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d6u3oc1:

Click to download the PDB-style file with coordinates for d6u3oc1.
(The format of our PDB-style files is described here.)

Timeline for d6u3oc1: