Lineage for d6u3nb2 (6u3n B:93-190)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757576Domain d6u3nb2: 6u3n B:93-190 [378454]
    Other proteins in same PDB: d6u3na1, d6u3na2, d6u3nb1, d6u3nd2, d6u3ne2
    automated match to d1sebb1
    complexed with nag

Details for d6u3nb2

PDB Entry: 6u3n (more details), 2.8 Å

PDB Description: ls2.8/3.15 - dq2-p.fluor-alpha1a complex
PDB Compounds: (B:) MHC class II HLA-DQ-beta-1

SCOPe Domain Sequences for d6u3nb2:

Sequence, based on SEQRES records: (download)

>d6u3nb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd
wtfqilvmlemtpqrgdvytchvehpslqspitvewra

Sequence, based on observed residues (ATOM records): (download)

>d6u3nb2 b.1.1.0 (B:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrveptvtispshnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilv
mlemtpqrgdvytchvehpslqspitvewra

SCOPe Domain Coordinates for d6u3nb2:

Click to download the PDB-style file with coordinates for d6u3nb2.
(The format of our PDB-style files is described here.)

Timeline for d6u3nb2: