Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6u3od2: 6u3o D:93-190 [378452] Other proteins in same PDB: d6u3oa2, d6u3ob2, d6u3oc1, d6u3oc2, d6u3od1, d6u3oe1, d6u3oe2, d6u3of1, d6u3og2, d6u3oh2 automated match to d1sebb1 |
PDB Entry: 6u3o (more details), 2.74 Å
SCOPe Domain Sequences for d6u3od2:
Sequence, based on SEQRES records: (download)
>d6u3od2 b.1.1.0 (D:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeetagvvstplirngd wtfqilvmlemtpqrgdvytchvehpslqspitvewra
>d6u3od2 b.1.1.0 (D:93-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} rrveptvtispshnllvcsvtdfypaqikvrwfrndqeetagvvstplirngdwtfqilv mlemtpqrgdvytchvehpslqspitvewra
Timeline for d6u3od2: