Lineage for d1f52g1 (1f52 G:1-100)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30769Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 30770Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 30771Protein Glutamine synthetase, N-terminal domain [54370] (1 species)
  7. 30772Species Salmonella typhimurium [TaxId:90371] [54371] (4 PDB entries)
  8. Domain d1f52g1: 1f52 G:1-100 [37845]
    Other proteins in same PDB: d1f52a2, d1f52b2, d1f52c2, d1f52d2, d1f52e2, d1f52f2, d1f52g2, d1f52h2, d1f52i2, d1f52j2, d1f52k2, d1f52l2

Details for d1f52g1

PDB Entry: 1f52 (more details), 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp

SCOP Domain Sequences for d1f52g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f52g1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1f52g1 are not available.

Timeline for d1f52g1:

Domains from same chain:
(mouse over for more information)
d1f52g2