SCOPe 2.08: Domain d1f52g1: 1f52 G:1-100

Lineage for d1f52g1 (1f52 G:1-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)

6. Protein Glutamine synthetase, N-terminal domain [54370] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)

8. Domain d1f52g1: 1f52 G:1-100 [37845]
   Other proteins in same PDB: d1f52a2, d1f52b2, d1f52c2, d1f52d2, d1f52e2, d1f52f2, d1f52g2, d1f52h2, d1f52i2, d1f52j2, d1f52k2, d1f52l2
   complexed with adp, mn, mpd

Details for d1f52g1

PDB Entry: 1f52, 2.49 Å

PDB Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp

PDB Compounds: (G:) glutamine synthetase

SCOPe Domain Sequences for d1f52g1:

Sequence; same for both SEQRES and ATOM records:

>d1f52g1 d.15.9.1 (G:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Timeline for d1f52g1:

• d1f52g1 first appeared (with stable ids) in SCOP 1.55
  
• d1f52g1 appears in SCOPe 2.07