Lineage for d6u3oe2 (6u3o E:82-181)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751336Domain d6u3oe2: 6u3o E:82-181 [378446]
    Other proteins in same PDB: d6u3oa1, d6u3ob1, d6u3oc1, d6u3od1, d6u3od2, d6u3oe1, d6u3of1, d6u3of2, d6u3og1, d6u3oh1
    automated match to d5ujta2

Details for d6u3oe2

PDB Entry: 6u3o (more details), 2.74 Å

PDB Description: jr51 dq2-p.aeru-alpha2a complex
PDB Compounds: (E:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6u3oe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u3oe2 b.1.1.2 (E:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltllpsaeesydckvehwgldkpllkhwepe

SCOPe Domain Coordinates for d6u3oe2:

Click to download the PDB-style file with coordinates for d6u3oe2.
(The format of our PDB-style files is described here.)

Timeline for d6u3oe2: