SCOPe 2.08: Domain d6u1vd2: 6u1v D:218-382

Lineage for d6u1vd2 (6u1v D:218-382)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Streptomyces tsukubensis [TaxId:1114943] [378439] (1 PDB entry)

8. Domain d6u1vd2: 6u1v D:218-382 [378440]
   Other proteins in same PDB: d6u1va1, d6u1va3, d6u1vb1, d6u1vb3, d6u1vc1, d6u1vd1
   automated match to d1ukwa1
   complexed with fda

Details for d6u1vd2

PDB Entry: 6u1v, 1.75 Å

PDB Description: crystal structure of acyl-acp/acyl-coa dehydrogenase from allylmalonyl-coa and fk506 biosynthesis, tcsd

PDB Compounds: (D:) Acyl-CoA dehydrogenase domain-containing protein

SCOPe Domain Sequences for d6u1vd2:

Sequence; same for both SEQRES and ATOM records:

>d6u1vd2 a.29.3.0 (D:218-382) automated matches {Streptomyces tsukubensis [TaxId: 1114943]}
gnglrlleiglnasriliaasalgvarrirdvcmeygktkslkgaplvkdgvfagrlgqf
emqidvmanqclaaaraydataarpdaarvllrqgaqksaltakmfcgqtawqiastase
mfggigythdmvigkllrdvrhasiieggddvlrdlvyqrfvvpt

Timeline for d6u1vd2:

• d6u1vd2 first appeared in SCOPe 2.07