SCOPe 2.08: Domain d6u1vd1: 6u1v D:1-217

Lineage for d6u1vd1 (6u1v D:1-217)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (29 species)
   not a true protein

7. Species Streptomyces tsukubensis [TaxId:1114943] [378437] (1 PDB entry)

8. Domain d6u1vd1: 6u1v D:1-217 [378438]
   Other proteins in same PDB: d6u1va2, d6u1va3, d6u1vb2, d6u1vb3, d6u1vc2, d6u1vd2
   automated match to d1ukwa2
   complexed with fda

Details for d6u1vd1

PDB Entry: 6u1v, 1.75 Å

PDB Description: crystal structure of acyl-acp/acyl-coa dehydrogenase from allylmalonyl-coa and fk506 biosynthesis, tcsd

PDB Compounds: (D:) Acyl-CoA dehydrogenase domain-containing protein

SCOPe Domain Sequences for d6u1vd1:

Sequence; same for both SEQRES and ATOM records:

>d6u1vd1 e.6.1.0 (D:1-217) automated matches {Streptomyces tsukubensis [TaxId: 1114943]}
mseserlgivrdfvareilgregildsladaplalyerfaetglmnwwvpkehgglglgl
eesvrivselaygdagvaftlflpvlttsmigwygseelkerflgplvarrgfcatlgse
heagselaristtvrrdgdtlvldgtkafststdfarflvviarsaddparytavtvprd
apglrvdkrwdvigmrasatyqvsfsdcrvpgdnaln

Timeline for d6u1vd1:

• d6u1vd1 first appeared in SCOPe 2.07