Lineage for d6stab1 (6sta B:2-160)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975569Protein automated matches [190058] (11 species)
    not a true protein
  7. 2975590Species Fragaria ananassa [TaxId:3747] [378413] (4 PDB entries)
  8. 2975596Domain d6stab1: 6sta B:2-160 [378435]
    Other proteins in same PDB: d6staa2, d6stab2
    automated match to d1h2oa_
    mutant

Details for d6stab1

PDB Entry: 6sta (more details), 2.19 Å

PDB Description: crystal structure of the strawberry pathogenesis-related 10 (pr-10) fra a 1.02 protein, e46a d48a mutant
PDB Compounds: (B:) Major strawberry allergen Fra a 1-2

SCOPe Domain Sequences for d6stab1:

Sequence, based on SEQRES records: (download)

>d6stab1 d.129.3.1 (B:2-160) automated matches {Fragaria ananassa [TaxId: 3747]}
gvftyeteftsvippprlfkafildadnlipkiapqavkcaeiiagaggvgtikkitfge
gsqfgsvthkidgidkenfvysysliegdalsdkiekisyetklvsssdggsiikstsny
htkgdveikeehvkagkekashlfklvegyllanpneyc

Sequence, based on observed residues (ATOM records): (download)

>d6stab1 d.129.3.1 (B:2-160) automated matches {Fragaria ananassa [TaxId: 3747]}
gvftyeteftsvippprlfkafildadnlipkiapqavkcaeiiagaggvgtikkitffg
svthkidgidkenfvysysliegdalsdkiekisyetklvsssdggsiikstsnyhtkgd
veikeehvkagkekashlfklvegyllanpneyc

SCOPe Domain Coordinates for d6stab1:

Click to download the PDB-style file with coordinates for d6stab1.
(The format of our PDB-style files is described here.)

Timeline for d6stab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6stab2