Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins) |
Protein automated matches [190058] (11 species) not a true protein |
Species Fragaria ananassa [TaxId:3747] [378413] (4 PDB entries) |
Domain d6st8a1: 6st8 A:2-160 [378414] Other proteins in same PDB: d6st8a2, d6st8b2 automated match to d1e09a_ |
PDB Entry: 6st8 (more details), 2.04 Å
SCOPe Domain Sequences for d6st8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6st8a1 d.129.3.1 (A:2-160) automated matches {Fragaria ananassa [TaxId: 3747]} gvftyeteftsvippprlfkafildadnlipkiapqavkcaeiiegdggvgtikkitfge gsqfgsvthkidgidkenfvysysliegdalsdkiekisyetklvsssdggsiikstsny htkgdveikeehvkagkekashlfklvegyllanpneyc
Timeline for d6st8a1: