SCOPe 2.08: Domain d6qfsd1: 6qfs D:2-106

Lineage for d6qfsd1 (6qfs D:2-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.1: Cellulose-binding domain family II [49385] (3 proteins)
   automatically mapped to Pfam PF00553

6. Protein automated matches [378345] (1 species)
   not a true protein

7. Species Cellulomonas fimi [TaxId:1708] [378346] (1 PDB entry)

8. Domain d6qfsd1: 6qfs D:2-106 [378411]
   Other proteins in same PDB: d6qfsb2, d6qfsd2, d6qfsg2, d6qfsh2
   automated match to d1exha_
   complexed with 1ps, act, edo, ete, fmt, gol, peg

Details for d6qfsd1

PDB Entry: 6qfs, 2.2 Å

PDB Description: chargeless variant of the cellulose-binding domain from cellulomonas fimi

PDB Compounds: (D:) Exoglucanase/xylanase

SCOPe Domain Sequences for d6qfsd1:

Sequence; same for both SEQRES and ATOM records:

>d6qfsd1 b.2.2.1 (D:2-106) automated matches {Cellulomonas fimi [TaxId: 1708]}
agcqvlwgvnqwntgftanvtvqntssapvqgwtltfsfpsgqqvtqawsstvtqsgsav
tvqnapwngsipaggtaqfgfngswtgtnaaptafslngtpctvg

Timeline for d6qfsd1:

• d6qfsd1 first appeared in SCOPe 2.07