SCOPe 2.07: Domain d6rwva1: 6rwv A:3-309

Lineage for d6rwva1 (6rwv A:3-309)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
   automatically mapped to Pfam PF00762

6. Protein automated matches [190319] (3 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [378402] (2 PDB entries)

8. Domain d6rwva1: 6rwv A:3-309 [378409]
   Other proteins in same PDB: d6rwva2
   automated match to d2c8ja_
   complexed with gol, k, po4

Details for d6rwva1

PDB Entry: 6rwv, 1.64 Å

PDB Description: structure of apo-lmcpfc

PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d6rwva1:

Sequence; same for both SEQRES and ATOM records:

>d6rwva1 c.92.1.1 (A:3-309) automated matches {Listeria monocytogenes [TaxId: 1639]}
kkvgllvmaygtpykdedieryytdirhghkpseemiadlrgryhaigglsplakiteaq
ayglekalndsqdevefkayiglkhiepfiedaveamhkdgieeaisivlaphyssfsve
aynkrakeaadklggprinaindwykqpkfiqmwadrinetakqipadelldtvlivsah
slpekikqhndpypnqlqetadfifekvvvphyalgwqsegktgepwlgpdvqdltrely
grekykhfiytpvgfvaehlevlydndyeckvvtdevgaayhrppmpnsdpeflevlrtv
vwekysn

Timeline for d6rwva1:

• d6rwva1 is new in SCOPe 2.07-stable
  
• d6rwva1 appears in the current release, SCOPe 2.08