Lineage for d6rwva1 (6rwv A:3-309)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912238Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2912239Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
    automatically mapped to Pfam PF00762
  6. 2912310Protein automated matches [190319] (3 species)
    not a true protein
  7. 2912319Species Listeria monocytogenes [TaxId:1639] [378402] (2 PDB entries)
  8. 2912320Domain d6rwva1: 6rwv A:3-309 [378409]
    Other proteins in same PDB: d6rwva2
    automated match to d2c8ja_
    complexed with gol, k, po4

Details for d6rwva1

PDB Entry: 6rwv (more details), 1.64 Å

PDB Description: structure of apo-lmcpfc
PDB Compounds: (A:) Ferrochelatase

SCOPe Domain Sequences for d6rwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rwva1 c.92.1.1 (A:3-309) automated matches {Listeria monocytogenes [TaxId: 1639]}
kkvgllvmaygtpykdedieryytdirhghkpseemiadlrgryhaigglsplakiteaq
ayglekalndsqdevefkayiglkhiepfiedaveamhkdgieeaisivlaphyssfsve
aynkrakeaadklggprinaindwykqpkfiqmwadrinetakqipadelldtvlivsah
slpekikqhndpypnqlqetadfifekvvvphyalgwqsegktgepwlgpdvqdltrely
grekykhfiytpvgfvaehlevlydndyeckvvtdevgaayhrppmpnsdpeflevlrtv
vwekysn

SCOPe Domain Coordinates for d6rwva1:

Click to download the PDB-style file with coordinates for d6rwva1.
(The format of our PDB-style files is described here.)

Timeline for d6rwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6rwva2