Lineage for d6sird_ (6sir D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561636Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561717Family d.58.29.0: automated matches [191671] (1 protein)
    not a true family
  6. 2561718Protein automated matches [191274] (13 species)
    not a true protein
  7. 2561724Species Catenaria anguillulae [TaxId:765915] [353236] (2 PDB entries)
  8. 2561728Domain d6sird_: 6sir D: [378406]
    automated match to d6ao9a_
    complexed with ca, gol, gtp

Details for d6sird_

PDB Entry: 6sir (more details), 1.7 Å

PDB Description: crystal structure of the guanylate cyclase domain of rhgc from catenaria anguillulae in complex with gtp
PDB Compounds: (D:) Nucleotide cyclase

SCOPe Domain Sequences for d6sird_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sird_ d.58.29.0 (D:) automated matches {Catenaria anguillulae [TaxId: 765915]}
akeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvetigdayl
gvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdlnph
wclvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvta
rk

SCOPe Domain Coordinates for d6sird_:

Click to download the PDB-style file with coordinates for d6sird_.
(The format of our PDB-style files is described here.)

Timeline for d6sird_: