Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.0: automated matches [191671] (1 protein) not a true family |
Protein automated matches [191274] (13 species) not a true protein |
Species Catenaria anguillulae [TaxId:765915] [353236] (2 PDB entries) |
Domain d6sird_: 6sir D: [378406] automated match to d6ao9a_ complexed with ca, gol, gtp |
PDB Entry: 6sir (more details), 1.7 Å
SCOPe Domain Sequences for d6sird_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sird_ d.58.29.0 (D:) automated matches {Catenaria anguillulae [TaxId: 765915]} akeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvetigdayl gvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdlnph wclvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvta rk
Timeline for d6sird_: