![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.1: Chelatase [53800] (4 families) ![]() interdomain linker is short; swapping of C-terminal helices between the two domains |
![]() | Family c.92.1.1: Ferrochelatase [53801] (2 proteins) automatically mapped to Pfam PF00762 |
![]() | Protein automated matches [190319] (3 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:1639] [378402] (2 PDB entries) |
![]() | Domain d6sv3a1: 6sv3 A:3-309 [378403] Other proteins in same PDB: d6sv3a2 automated match to d2c8ja_ complexed with fec, gol |
PDB Entry: 6sv3 (more details), 1.64 Å
SCOPe Domain Sequences for d6sv3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6sv3a1 c.92.1.1 (A:3-309) automated matches {Listeria monocytogenes [TaxId: 1639]} kkvgllvmaygtpykdedieryytdirhghkpseemiadlrgryhaigglsplakiteaq ayglekalndsqdevefkayiglkhiepfiedaveamhkdgieeaisivlaphyssfsve aynkrakeaadklggprinaindwykqpkfiqmwadrinetakqipadelldtvlivsah slpekikqhndpypnqlqetadfifekvvvphyalgwqsegktgepwlgpdvqdltrely grekykhfiytpvgfvaehlevlydndyeckvvtdevgaayhrppmpnsdpeflevlrtv vwekysn
Timeline for d6sv3a1: