Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.0: automated matches [191368] (1 protein) not a true family |
Protein automated matches [190445] (12 species) not a true protein |
Species Brassica oleracea [TaxId:3715] [378394] (1 PDB entry) |
Domain d6s2za_: 6s2z A: [378395] automated match to d1r8na_ complexed with chl |
PDB Entry: 6s2z (more details), 2.5 Å
SCOPe Domain Sequences for d6s2za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s2za_ b.42.4.0 (A:) automated matches {Brassica oleracea [TaxId: 3715]} reqvkdsngnpvkrgakyfiqpaksnggglvpaainilpfcplgitqtllpyqpglpvsf gyepvivgtdyiytsttiniefrseiwpvcnelsklwavdvsssaakepaiiiggertap nslfkieeatgahtyklttssgtvgtipgpwlgapqliatnddaktlfvkfvkvd
Timeline for d6s2za_: