Lineage for d2lgsa1 (2lgs A:1-100)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30769Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 30770Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 30771Protein Glutamine synthetase, N-terminal domain [54370] (1 species)
  7. 30772Species Salmonella typhimurium [TaxId:90371] [54371] (4 PDB entries)
  8. 30774Domain d2lgsa1: 2lgs A:1-100 [37838]
    Other proteins in same PDB: d2lgsa2

Details for d2lgsa1

PDB Entry: 2lgs (more details), 2.8 Å

PDB Description: feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine

SCOP Domain Sequences for d2lgsa1:

Sequence, based on SEQRES records: (download)

>d2lgsa1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records): (download)

>d2lgsa1 d.15.9.1 (A:1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d2lgsa1:

Click to download the PDB-style file with coordinates for d2lgsa1.
(The format of our PDB-style files is described here.)

Timeline for d2lgsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lgsa2