Lineage for d1lgr_1 (1lgr 1-100)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254568Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 254569Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 254570Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 254620Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 254645Domain d1lgr_1: 1lgr 1-100 [37837]
    Other proteins in same PDB: d1lgr_2
    complexed with amp, mn

Details for d1lgr_1

PDB Entry: 1lgr (more details), 2.8 Å

PDB Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium

SCOP Domain Sequences for d1lgr_1:

Sequence, based on SEQRES records: (download)

>d1lgr_1 d.15.9.1 (1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records): (download)

>d1lgr_1 d.15.9.1 (1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1lgr_1:

Click to download the PDB-style file with coordinates for d1lgr_1.
(The format of our PDB-style files is described here.)

Timeline for d1lgr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lgr_2