Lineage for d1lgr_1 (1lgr 1-100)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189214Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 189739Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (1 family) (S)
  5. 189740Family d.15.9.1: Glutamine synthetase, N-terminal domain [54369] (1 protein)
  6. 189741Protein Glutamine synthetase, N-terminal domain [54370] (2 species)
  7. 189791Species Salmonella typhimurium [TaxId:90371] [54371] (6 PDB entries)
  8. 189816Domain d1lgr_1: 1lgr 1-100 [37837]
    Other proteins in same PDB: d1lgr_2

Details for d1lgr_1

PDB Entry: 1lgr (more details), 2.8 Å

PDB Description: interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium

SCOP Domain Sequences for d1lgr_1:

Sequence, based on SEQRES records: (download)

>d1lgr_1 d.15.9.1 (1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
nesdmvlmpdastavidpffadstliircdilepgtlqgy

Sequence, based on observed residues (ATOM records): (download)

>d1lgr_1 d.15.9.1 (1-100) Glutamine synthetase, N-terminal domain {Salmonella typhimurium}
saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwdmv
lmpdastavidpffadstliircdilepgtlqgy

SCOP Domain Coordinates for d1lgr_1:

Click to download the PDB-style file with coordinates for d1lgr_1.
(The format of our PDB-style files is described here.)

Timeline for d1lgr_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lgr_2