Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins) probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model |
Protein automated matches [197305] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [197306] (13 PDB entries) |
Domain d5qiva_: 5qiv A: [378363] automated match to d4fjva_ complexed with edo, j5p, unl |
PDB Entry: 5qiv (more details), 1.39 Å
SCOPe Domain Sequences for d5qiva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qiva_ d.3.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fnlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesll gksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndq sasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsq alsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilya
Timeline for d5qiva_: