Lineage for d1tifa_ (1tif A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160670Superfamily d.15.8: Translation initiation factor IF3, N-terminal domain [54364] (1 family) (S)
    automatically mapped to Pfam PF05198
  5. 2160671Family d.15.8.1: Translation initiation factor IF3, N-terminal domain [54365] (1 protein)
  6. 2160672Protein Translation initiation factor IF3, N-terminal domain [54366] (1 species)
  7. 2160673Species Bacillus stearothermophilus [TaxId:1422] [54367] (1 PDB entry)
  8. 2160674Domain d1tifa_: 1tif A: [37836]
    complexed with cl, pbm

Details for d1tifa_

PDB Entry: 1tif (more details), 1.8 Å

PDB Description: translation initiation factor 3 n-terminal domain
PDB Compounds: (A:) translation initiation factor 3

SCOPe Domain Sequences for d1tifa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tifa_ d.15.8.1 (A:) Translation initiation factor IF3, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
kdfiineqirarevrlidqngdqlgikskqealeiaarrnldlvlvapnakppvcrimdy
gkfrfeqqkkekeark

SCOPe Domain Coordinates for d1tifa_:

Click to download the PDB-style file with coordinates for d1tifa_.
(The format of our PDB-style files is described here.)

Timeline for d1tifa_: