![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
![]() | Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species) |
![]() | Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries) |
![]() | Domain d2ptl__: 2ptl - [37835] b1 domain |
PDB Entry: 2ptl (more details)
SCOP Domain Sequences for d2ptl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ptl__ d.15.7.1 (-) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus} enkeetpetpetdseeevtikanlifangstqtaefkgtfekatseayayadtlkkdnge ytvdvadkgytlnikfag
Timeline for d2ptl__: