Lineage for d2ptl__ (2ptl -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325904Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 325905Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 325906Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 325907Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)
  8. 325927Domain d2ptl__: 2ptl - [37835]
    b1 domain

Details for d2ptl__

PDB Entry: 2ptl (more details)

PDB Description: three-dimensional solution structure of an immunoglobulin light chain- binding domain of protein l. comparison with the igg-binding domains of protein g
PDB Compounds: ( :)

SCOP Domain Sequences for d2ptl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptl__ d.15.7.1 (-) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
enkeetpetpetdseeevtikanlifangstqtaefkgtfekatseayayadtlkkdnge
ytvdvadkgytlnikfag

SCOP Domain Coordinates for d2ptl__:

Click to download the PDB-style file with coordinates for d2ptl__.
(The format of our PDB-style files is described here.)

Timeline for d2ptl__: