Lineage for d5qita_ (5qit A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497910Family d.3.1.11: Ubiquitin thiolesterase protein OTUB2 (Otubain-2) [110773] (2 proteins)
    probably the same as Pfam PF02338, OTU-like cysteine protease, but 1TFF (Uniprot Q96DC9) was not detected by the Pfam model
  6. 2497914Protein automated matches [197305] (1 species)
    not a true protein
  7. 2497915Species Human (Homo sapiens) [TaxId:9606] [197306] (13 PDB entries)
  8. 3078278Domain d5qita_: 5qit A: [378340]
    automated match to d4fjva_
    complexed with edo, j5j, peg

Details for d5qita_

PDB Entry: 5qit (more details), 1.46 Å

PDB Description: covalent fragment group deposition -- crystal structure of outb2 in complex with pcm-0102821
PDB Compounds: (A:) Ubiquitin thioesterase OTUB2

SCOPe Domain Sequences for d5qita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qita_ d.3.1.11 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnlisekcdilsilrdhpenriyrrkieelskrftairktkgdrncfyralgysylesll
gksreifkfkervlqtpndllaagfeehkfrnffnafysvvelvekdgsvssllkvfndq
sasdhivqflrlltsafirnradffrhfideemdikdfcthevepmatecdhiqitalsq
alsialqveyvdemdtalnhhvfpeaatpsvyllyktshynilya

SCOPe Domain Coordinates for d5qita_:

Click to download the PDB-style file with coordinates for d5qita_.
(The format of our PDB-style files is described here.)

Timeline for d5qita_:

  • d5qita_ is new in SCOPe 2.07-stable