Lineage for d2gb1a_ (2gb1 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718046Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 718047Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 718072Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 718073Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries)
  8. 718109Domain d2gb1a_: 2gb1 A: [37834]

Details for d2gb1a_

PDB Entry: 2gb1 (more details)

PDB Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
PDB Compounds: (A:) protein g

SCOP Domain Sequences for d2gb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gb1a_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOP Domain Coordinates for d2gb1a_:

Click to download the PDB-style file with coordinates for d2gb1a_.
(The format of our PDB-style files is described here.)

Timeline for d2gb1a_: