Lineage for d1gb4__ (1gb4 -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131315Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 131316Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 131338Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 131339Species Streptococcus sp., group G [TaxId:1306] [54361] (16 PDB entries)
  8. 131352Domain d1gb4__: 1gb4 - [37833]

Details for d1gb4__

PDB Entry: 1gb4 (more details)

PDB Description: hyperthermophilic variant of the b1 domain from streptococcal protein g, nmr, 47 structures

SCOP Domain Sequences for d1gb4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gb4__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mttfkliingktlkgeitieavdaaeaekifkqyandngidgewtyddatktftvte

SCOP Domain Coordinates for d1gb4__:

Click to download the PDB-style file with coordinates for d1gb4__.
(The format of our PDB-style files is described here.)

Timeline for d1gb4__: