Lineage for d6pxbd_ (6pxb D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572320Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)
  8. 2572339Domain d6pxbd_: 6pxb D: [378324]
    automated match to d1blka_

Details for d6pxbd_

PDB Entry: 6pxb (more details), 1.75 Å

PDB Description: n-terminal sh2 domain of the p120rasgap
PDB Compounds: (D:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d6pxbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pxbd_ d.93.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsgdy
yiggrrfsslsdligyyshvssllkgekllypvappepved

SCOPe Domain Coordinates for d6pxbd_:

Click to download the PDB-style file with coordinates for d6pxbd_.
(The format of our PDB-style files is described here.)

Timeline for d6pxbd_: