Lineage for d6pxbc_ (6pxb C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965724Domain d6pxbc_: 6pxb C: [378317]
    automated match to d1blka_

Details for d6pxbc_

PDB Entry: 6pxb (more details), 1.75 Å

PDB Description: n-terminal sh2 domain of the p120rasgap
PDB Compounds: (C:) Ras GTPase-activating protein 1

SCOPe Domain Sequences for d6pxbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pxbc_ d.93.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqwyhgkldrtiaeerlrqagksgsyliresdrrpgsfvlsflsqmnvvnhfriiamsg
dyyiggrrfsslsdligyyshvssllkgekllypvappepved

SCOPe Domain Coordinates for d6pxbc_:

Click to download the PDB-style file with coordinates for d6pxbc_.
(The format of our PDB-style files is described here.)

Timeline for d6pxbc_: