Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [196398] (6 PDB entries) |
Domain d6pbuf_: 6pbu F: [378310] automated match to d1tg6g_ complexed with mli |
PDB Entry: 6pbu (more details), 2 Å
SCOPe Domain Sequences for d6pbuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pbuf_ c.14.1.0 (F:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} lnlvdsvyerllaeriiflgsqvdddianrlcaqilllsaedptkdihlyinspggsisa gmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsa adiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaqealeygfvdhiitsa svngegpgagld
Timeline for d6pbuf_: