Lineage for d6pbuf_ (6pbu F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853968Species Mycobacterium smegmatis [TaxId:246196] [196398] (6 PDB entries)
  8. 2853991Domain d6pbuf_: 6pbu F: [378310]
    automated match to d1tg6g_
    complexed with mli

Details for d6pbuf_

PDB Entry: 6pbu (more details), 2 Å

PDB Description: clpp1 from mycobacterium smegmatis
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6pbuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pbuf_ c.14.1.0 (F:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
lnlvdsvyerllaeriiflgsqvdddianrlcaqilllsaedptkdihlyinspggsisa
gmaiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsa
adiaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaqealeygfvdhiitsa
svngegpgagld

SCOPe Domain Coordinates for d6pbuf_:

Click to download the PDB-style file with coordinates for d6pbuf_.
(The format of our PDB-style files is described here.)

Timeline for d6pbuf_: