SCOP 1.61: Domain d2igg__: 2igg -

Lineage for d2igg__ (2igg -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (17 PDB entries)

8. Domain d2igg__: 2igg - [37831]

Details for d2igg__

PDB Entry: 2igg

PDB Description: determination of the solution structures of domains ii and iii of protein g from streptococcus by 1h nmr

SCOP Domain Sequences for d2igg__:

Sequence; same for both SEQRES and ATOM records:

>d2igg__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
ltpavttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvt
ekpe

Timeline for d2igg__:

• d2igg__ first appeared (with stable ids) in SCOP 1.55
  
• d2igg__ appears in SCOP 1.59
  
• d2igg__ appears in SCOP 1.63
  
• d2igg__ appears in the current release, SCOPe 2.08, called d2igga_