Lineage for d1gb1a_ (1gb1 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1196044Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1196045Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1196070Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)
  7. 1196077Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)
  8. 1196123Domain d1gb1a_: 1gb1 A: [37830]

Details for d1gb1a_

PDB Entry: 1gb1 (more details)

PDB Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
PDB Compounds: (A:) protein g

SCOPe Domain Sequences for d1gb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gb1a_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d1gb1a_:

Click to download the PDB-style file with coordinates for d1gb1a_.
(The format of our PDB-style files is described here.)

Timeline for d1gb1a_: