SCOP 1.57: Domain d1fccc_: 1fcc C:

Lineage for d1fccc_ (1fcc C:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (16 PDB entries)

8. Domain d1fccc_: 1fcc C: [37829]
   Other proteins in same PDB: d1fcca1, d1fcca2

Details for d1fccc_

PDB Entry: 1fcc, 3.5 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg

SCOP Domain Sequences for d1fccc_:

Sequence; same for both SEQRES and ATOM records:

>d1fccc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

Timeline for d1fccc_:

• d1fccc_ first appeared (with stable ids) in SCOP 1.55
  
• d1fccc_ appears in SCOP 1.59
  
• d1fccc_ appears in the current release, SCOPe 2.08