Lineage for d1fccc_ (1fcc C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78181Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 78182Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 78192Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 78193Species Streptococcus sp., group G [TaxId:1306] [54361] (16 PDB entries)
  8. 78203Domain d1fccc_: 1fcc C: [37829]
    Other proteins in same PDB: d1fcca1, d1fcca2

Details for d1fccc_

PDB Entry: 1fcc (more details), 3.5 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg

SCOP Domain Sequences for d1fccc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fccc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOP Domain Coordinates for d1fccc_:

Click to download the PDB-style file with coordinates for d1fccc_.
(The format of our PDB-style files is described here.)

Timeline for d1fccc_: