![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
![]() | Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species) |
![]() | Species Streptococcus sp., group G [TaxId:1306] [54361] (14 PDB entries) |
![]() | Domain d1fccc_: 1fcc C: [37829] Other proteins in same PDB: d1fcca1, d1fcca2 |
PDB Entry: 1fcc (more details), 3.5 Å
SCOP Domain Sequences for d1fccc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fccc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G} ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte
Timeline for d1fccc_: