Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species) |
Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries) |
Domain d1fccc_: 1fcc C: [37829] Other proteins in same PDB: d1fcca1, d1fcca2, d1fccb1, d1fccb2 |
PDB Entry: 1fcc (more details), 3.2 Å
SCOPe Domain Sequences for d1fccc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fccc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte
Timeline for d1fccc_: