Lineage for d1fccc_ (1fcc C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934668Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2934705Species Streptococcus sp., group G [TaxId:1306] [54361] (40 PDB entries)
  8. 2934747Domain d1fccc_: 1fcc C: [37829]
    Other proteins in same PDB: d1fcca1, d1fcca2, d1fccb1, d1fccb2

Details for d1fccc_

PDB Entry: 1fcc (more details), 3.2 Å

PDB Description: crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg
PDB Compounds: (C:) streptococcal protein g (c2 fragment)

SCOPe Domain Sequences for d1fccc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fccc_ d.15.7.1 (C:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
ttyklvingktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d1fccc_:

Click to download the PDB-style file with coordinates for d1fccc_.
(The format of our PDB-style files is described here.)

Timeline for d1fccc_: