SCOPe 2.01: Domain d3gb1a_: 3gb1 A:

Lineage for d3gb1a_ (3gb1 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (2 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)

8. Domain d3gb1a_: 3gb1 A: [37828]

Details for d3gb1a_

PDB Entry: 3gb1

PDB Description: structures of b1 domain of streptococcal protein g

PDB Compounds: (A:) protein (b1 domain of streptococcal protein g)

SCOPe Domain Sequences for d3gb1a_:

Sequence; same for both SEQRES and ATOM records:

>d3gb1a_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

Timeline for d3gb1a_:

• d3gb1a_ first appeared (with stable ids) in SCOP 1.55
  
• d3gb1a_ appears in SCOP 1.75
  
• d3gb1a_ appears in SCOPe 2.02
  
• d3gb1a_ appears in the current release, SCOPe 2.08