![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins) |
![]() | Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species) |
![]() | Species Streptococcus sp., group G [TaxId:1306] [54361] (14 PDB entries) |
![]() | Domain d1igca_: 1igc A: [37827] Other proteins in same PDB: d1igch1, d1igch2, d1igcl1, d1igcl2 |
PDB Entry: 1igc (more details), 2.6 Å
SCOP Domain Sequences for d1igca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igca_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G} avttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvte
Timeline for d1igca_:
![]() Domains from other chains: (mouse over for more information) d1igch1, d1igch2, d1igcl1, d1igcl2 |