![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) ![]() |
![]() | Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
![]() | Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species) |
![]() | Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries) |
![]() | Domain d1qkza_: 1qkz A: [37826] Other proteins in same PDB: d1qkzh1, d1qkzh2, d1qkzl1, d1qkzl2 |
PDB Entry: 1qkz (more details), 1.95 Å
SCOPe Domain Sequences for d1qkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkza_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]} vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek
Timeline for d1qkza_:
![]() Domains from other chains: (mouse over for more information) d1qkzh1, d1qkzh2, d1qkzl1, d1qkzl2 |