Lineage for d1qkza_ (1qkz A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403793Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1403794Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1403819Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)
  7. 1403828Species Streptococcus sp., group G [TaxId:1306] [54361] (31 PDB entries)
  8. 1403841Domain d1qkza_: 1qkz A: [37826]
    Other proteins in same PDB: d1qkzh1, d1qkzh2, d1qkzl1, d1qkzl2

Details for d1qkza_

PDB Entry: 1qkz (more details), 1.95 Å

PDB Description: fab fragment (mn14c11.6) in complex with a peptide antigen derived from neisseria meningitidis p1.7 serosubtype antigen and domain ii from streptococcal protein g
PDB Compounds: (A:) protein g-prime

SCOPe Domain Sequences for d1qkza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkza_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
vttyklvingktlkgetttkavdaataekvfkqyandngvdgewtyddatktftvtek

SCOPe Domain Coordinates for d1qkza_:

Click to download the PDB-style file with coordinates for d1qkza_.
(The format of our PDB-style files is described here.)

Timeline for d1qkza_: