Lineage for d6j5ya1 (6j5y A:2-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004772Family d.177.1.0: automated matches [191367] (1 protein)
    not a true family
  6. 3004773Protein automated matches [190444] (5 species)
    not a true protein
  7. 3004804Species Pseudomonas aeruginosa [TaxId:287] [378238] (1 PDB entry)
  8. 3004805Domain d6j5ya1: 6j5y A:2-232 [378239]
    Other proteins in same PDB: d6j5ya2
    automated match to d3s52a_
    complexed with mn, pyr

Details for d6j5ya1

PDB Entry: 6j5y (more details), 1.98 Å

PDB Description: crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate
PDB Compounds: (A:) FAA hydrolase family protein

SCOPe Domain Sequences for d6j5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j5ya1 d.177.1.0 (A:2-232) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
nhlfapeapvsltihgsdqtfpvrrvycvgrnyaaharemgfdpereppfffckpadavv
pvaagstlelaypsqtgnyhyeielvaaigkggcdipleqaeehvwgyavgldmtrrdlq
mrmremgrpweigkafdrsapigplypasqvghprhaaislqvdgedrqrsdidqliwsv
aetvsylsrffelrpgdlvftgtpegvgavergermlgaidglgelsvrvv

SCOPe Domain Coordinates for d6j5ya1:

Click to download the PDB-style file with coordinates for d6j5ya1.
(The format of our PDB-style files is described here.)

Timeline for d6j5ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6j5ya2