Lineage for d1pgxa_ (1pgx A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854651Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 854652Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 854677Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 854678Species Streptococcus sp., group G [TaxId:1306] [54361] (28 PDB entries)
  8. 854681Domain d1pgxa_: 1pgx A: [37823]

Details for d1pgxa_

PDB Entry: 1pgx (more details), 1.66 Å

PDB Description: the 1.66 angstroms x-ray structure of the b2 immunoglobulin-binding domain of streptococcal protein g and comparison to the nmr structure of the b1 domain
PDB Compounds: (A:) protein g

SCOP Domain Sequences for d1pgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgxa_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
eltpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftv
temvtevpva

SCOP Domain Coordinates for d1pgxa_:

Click to download the PDB-style file with coordinates for d1pgxa_.
(The format of our PDB-style files is described here.)

Timeline for d1pgxa_: