Lineage for d6ixxa2 (6ixx A:262-480)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2422942Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2423213Superfamily b.80.7: beta-Roll [51120] (2 families) (S)
    superhelix turns are made of two short strands each
  5. 2423244Family b.80.7.0: automated matches [227284] (1 protein)
    not a true family
  6. 2423245Protein automated matches [227101] (2 species)
    not a true protein
  7. 2423246Species Flavobacterium sp. [TaxId:686394] [226518] (2 PDB entries)
  8. 2423248Domain d6ixxa2: 6ixx A:262-480 [378229]
    Other proteins in same PDB: d6ixxa1, d6ixxi_
    automated match to d3u1ra2
    complexed with ca, zn

Details for d6ixxa2

PDB Entry: 6ixx (more details), 2 Å

PDB Description: crystal structure of a complex between psychrophilic marine protease mp and its inhibitor lupi
PDB Compounds: (A:) Alkaline metalloprotease

SCOPe Domain Sequences for d6ixxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ixxa2 b.80.7.0 (A:262-480) automated matches {Flavobacterium sp. [TaxId: 686394]}
anmetragdtvygfnstadrdyysatsatdklifsvwdgggndtldfsgfsqnqkinlaa
gsfsdvggmtgnvsiaqgvtienaiggsgndlllgnaasnilkggagndiiyggggadkl
wggsgsdtfvyrevsdstpkaadtlmdfqtgldkidltgithlsglnfvnaftgqagdav
vsynqasnagslqvdfsghgvadflittvgqvatydiva

SCOPe Domain Coordinates for d6ixxa2:

Click to download the PDB-style file with coordinates for d6ixxa2.
(The format of our PDB-style files is described here.)

Timeline for d6ixxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ixxa1
View in 3D
Domains from other chains:
(mouse over for more information)
d6ixxi_