SCOPe 2.08: Domain d6ixxa2: 6ixx A:262-480

Lineage for d6ixxa2 (6ixx A:262-480)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.7: beta-Roll [51120] (2 families)
   superhelix turns are made of two short strands each

5. Family b.80.7.0: automated matches [227284] (1 protein)
   not a true family

6. Protein automated matches [227101] (2 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:686394] [226518] (2 PDB entries)

8. Domain d6ixxa2: 6ixx A:262-480 [378229]
   Other proteins in same PDB: d6ixxa1, d6ixxi_
   automated match to d3u1ra2
   complexed with ca, zn

Details for d6ixxa2

PDB Entry: 6ixx, 2 Å

PDB Description: crystal structure of a complex between psychrophilic marine protease mp and its inhibitor lupi

PDB Compounds: (A:) Alkaline metalloprotease

SCOPe Domain Sequences for d6ixxa2:

Sequence; same for both SEQRES and ATOM records:

>d6ixxa2 b.80.7.0 (A:262-480) automated matches {Flavobacterium sp. [TaxId: 686394]}
anmetragdtvygfnstadrdyysatsatdklifsvwdgggndtldfsgfsqnqkinlaa
gsfsdvggmtgnvsiaqgvtienaiggsgndlllgnaasnilkggagndiiyggggadkl
wggsgsdtfvyrevsdstpkaadtlmdfqtgldkidltgithlsglnfvnaftgqagdav
vsynqasnagslqvdfsghgvadflittvgqvatydiva

Timeline for d6ixxa2:

• d6ixxa2 first appeared in SCOPe 2.07