| Class b: All beta proteins [48724] (180 folds) |
| Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.7: beta-Roll [51120] (2 families) ![]() superhelix turns are made of two short strands each |
| Family b.80.7.0: automated matches [227284] (1 protein) not a true family |
| Protein automated matches [227101] (2 species) not a true protein |
| Species Flavobacterium sp. [TaxId:686394] [226518] (2 PDB entries) |
| Domain d6ixxa2: 6ixx A:262-480 [378229] Other proteins in same PDB: d6ixxa1, d6ixxi_ automated match to d3u1ra2 complexed with ca, zn |
PDB Entry: 6ixx (more details), 2 Å
SCOPe Domain Sequences for d6ixxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ixxa2 b.80.7.0 (A:262-480) automated matches {Flavobacterium sp. [TaxId: 686394]}
anmetragdtvygfnstadrdyysatsatdklifsvwdgggndtldfsgfsqnqkinlaa
gsfsdvggmtgnvsiaqgvtienaiggsgndlllgnaasnilkggagndiiyggggadkl
wggsgsdtfvyrevsdstpkaadtlmdfqtgldkidltgithlsglnfvnaftgqagdav
vsynqasnagslqvdfsghgvadflittvgqvatydiva
Timeline for d6ixxa2: