![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
![]() | Protein automated matches [227100] (1 species) not a true protein |
![]() | Species Flavobacterium sp. [TaxId:686394] [226517] (2 PDB entries) |
![]() | Domain d6ixxa1: 6ixx A:18-261 [378228] Other proteins in same PDB: d6ixxa2, d6ixxi_ automated match to d3u1ra1 complexed with ca, zn |
PDB Entry: 6ixx (more details), 2 Å
SCOPe Domain Sequences for d6ixxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ixxa1 d.92.1.6 (A:18-261) automated matches {Flavobacterium sp. [TaxId: 686394]} angtssaftqvdnfshfydrgnhlvngkpsftvdqaadqltrsgaswydlngdgvinlsy tfltspppgyasrglgtfssfsglqkeqaklsleswadvakvtftegpaargddghmtfa nfsasnggaafaylpnssrkgeswylinkdydvnktpgegnygrqtltheightlglshp gdynagngnpsyrdavygedtraysvmsywsekntgqvftktgegayasapllddiaavq klyg
Timeline for d6ixxa1: