SCOPe 2.08: Domain d6ixxa1: 6ixx A:18-261

Lineage for d6ixxa1 (6ixx A:18-261)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein automated matches [227100] (1 species)
   not a true protein

7. Species Flavobacterium sp. [TaxId:686394] [226517] (2 PDB entries)

8. Domain d6ixxa1: 6ixx A:18-261 [378228]
   Other proteins in same PDB: d6ixxa2, d6ixxi_
   automated match to d3u1ra1
   complexed with ca, zn

Details for d6ixxa1

PDB Entry: 6ixx, 2 Å

PDB Description: crystal structure of a complex between psychrophilic marine protease mp and its inhibitor lupi

PDB Compounds: (A:) Alkaline metalloprotease

SCOPe Domain Sequences for d6ixxa1:

Sequence; same for both SEQRES and ATOM records:

>d6ixxa1 d.92.1.6 (A:18-261) automated matches {Flavobacterium sp. [TaxId: 686394]}
angtssaftqvdnfshfydrgnhlvngkpsftvdqaadqltrsgaswydlngdgvinlsy
tfltspppgyasrglgtfssfsglqkeqaklsleswadvakvtftegpaargddghmtfa
nfsasnggaafaylpnssrkgeswylinkdydvnktpgegnygrqtltheightlglshp
gdynagngnpsyrdavygedtraysvmsywsekntgqvftktgegayasapllddiaavq
klyg

Timeline for d6ixxa1:

• d6ixxa1 first appeared in SCOPe 2.07