Lineage for d6ixxa1 (6ixx A:18-261)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963971Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2964001Protein automated matches [227100] (1 species)
    not a true protein
  7. 2964002Species Flavobacterium sp. [TaxId:686394] [226517] (2 PDB entries)
  8. 2964004Domain d6ixxa1: 6ixx A:18-261 [378228]
    Other proteins in same PDB: d6ixxa2, d6ixxi_
    automated match to d3u1ra1
    complexed with ca, zn

Details for d6ixxa1

PDB Entry: 6ixx (more details), 2 Å

PDB Description: crystal structure of a complex between psychrophilic marine protease mp and its inhibitor lupi
PDB Compounds: (A:) Alkaline metalloprotease

SCOPe Domain Sequences for d6ixxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ixxa1 d.92.1.6 (A:18-261) automated matches {Flavobacterium sp. [TaxId: 686394]}
angtssaftqvdnfshfydrgnhlvngkpsftvdqaadqltrsgaswydlngdgvinlsy
tfltspppgyasrglgtfssfsglqkeqaklsleswadvakvtftegpaargddghmtfa
nfsasnggaafaylpnssrkgeswylinkdydvnktpgegnygrqtltheightlglshp
gdynagngnpsyrdavygedtraysvmsywsekntgqvftktgegayasapllddiaavq
klyg

SCOPe Domain Coordinates for d6ixxa1:

Click to download the PDB-style file with coordinates for d6ixxa1.
(The format of our PDB-style files is described here.)

Timeline for d6ixxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ixxa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6ixxi_