Lineage for d6ixxi_ (6ixx I:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2416046Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) (S)
  5. 2416067Family b.61.2.0: automated matches [378206] (1 protein)
    not a true family
  6. 2416068Protein automated matches [378207] (1 species)
    not a true protein
  7. 2416069Species Flavobacterium sp. [TaxId:686394] [378208] (2 PDB entries)
  8. 2416071Domain d6ixxi_: 6ixx I: [378227]
    Other proteins in same PDB: d6ixxa1, d6ixxa2
    automated match to d1jiwi_
    complexed with ca, zn

Details for d6ixxi_

PDB Entry: 6ixx (more details), 2 Å

PDB Description: crystal structure of a complex between psychrophilic marine protease mp and its inhibitor lupi
PDB Compounds: (I:) LupI

SCOPe Domain Sequences for d6ixxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ixxi_ b.61.2.0 (I:) automated matches {Flavobacterium sp. [TaxId: 686394]}
slmllspaqvagswtfyvqgaeqdactvtlkkdrtfsaqvsclqawlgrtpttwsptpdg
llligkdgsqslflelreagryegsvegsktlvmqra

SCOPe Domain Coordinates for d6ixxi_:

Click to download the PDB-style file with coordinates for d6ixxi_.
(The format of our PDB-style files is described here.)

Timeline for d6ixxi_: