![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) ![]() |
![]() | Family b.61.2.0: automated matches [378206] (1 protein) not a true family |
![]() | Protein automated matches [378207] (1 species) not a true protein |
![]() | Species Flavobacterium sp. [TaxId:686394] [378208] (2 PDB entries) |
![]() | Domain d6ixxi_: 6ixx I: [378227] Other proteins in same PDB: d6ixxa1, d6ixxa2 automated match to d1jiwi_ complexed with ca, zn |
PDB Entry: 6ixx (more details), 2 Å
SCOPe Domain Sequences for d6ixxi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ixxi_ b.61.2.0 (I:) automated matches {Flavobacterium sp. [TaxId: 686394]} slmllspaqvagswtfyvqgaeqdactvtlkkdrtfsaqvsclqawlgrtpttwsptpdg llligkdgsqslflelreagryegsvegsktlvmqra
Timeline for d6ixxi_: