SCOPe 2.08: Domain d6ixtc_: 6ixt C:

Lineage for d6ixtc_ (6ixt C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.0: automated matches [191423] (1 protein)
   not a true family

6. Protein automated matches [190603] (25 species)
   not a true protein

7. Species Ostreococcus tauri [TaxId:70448] [378192] (4 PDB entries)

8. Domain d6ixtc_: 6ixt C: [378220]
   automated match to d2qfwd_
   complexed with gol, mg, nad, so4

Details for d6ixtc_

PDB Entry: 6ixt, 1.78 Å

PDB Description: crystal structure of isocitrate dehydrogenase from ostreococcus tauri in complex with nad+ and mg2+

PDB Compounds: (C:) isocitrate dehydrogenase

SCOPe Domain Sequences for d6ixtc_:

Sequence; same for both SEQRES and ATOM records:

>d6ixtc_ c.77.1.0 (C:) automated matches {Ostreococcus tauri [TaxId: 70448]}
skitaapmvyvrgeemtayvmdlirsrwieprvdvggwetfdlraknrddtedrvlrdvi
eagkrikaifkeptvtptadqvkrlglrkswgspngamrrgwngitisrdtihidgvelg
ykkpvlferhavggeysagyknvgkgkltttftpsegpdagktvvvdereivdeeaavvt
yhnpydnvhdlarfffgrcleakvtpyvvtkktvfkwqepfwqimrtvfdeefkaqfvaa
gvmkegeelvhllsdaatmklvqwrqggfgmaahnydgdvltdelaqvhkspgfitsnlv
gvhedgtlikefeashgtvadmdearlrgeetslnplgmvegligamnhaadvhnidrdr
thafttkmrtvihqlfregkgtrdlcgpsgltteqfidavaerld

Timeline for d6ixtc_:

• d6ixtc_ first appeared in SCOPe 2.07