Lineage for d1igd__ (1igd -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130887Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 131315Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 131316Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 131338Protein Immunoglobulin-binding protein G, different constituent domains [54360] (1 species)
  7. 131339Species Streptococcus sp., group G [TaxId:1306] [54361] (16 PDB entries)
  8. 131341Domain d1igd__: 1igd - [37822]

Details for d1igd__

PDB Entry: 1igd (more details), 1.1 Å

PDB Description: the third igg-binding domain from streptococcal protein g: an analysis by x-ray crystallography of the structure alone and in a complex with fab

SCOP Domain Sequences for d1igd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igd__ d.15.7.1 (-) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G}
mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
e

SCOP Domain Coordinates for d1igd__:

Click to download the PDB-style file with coordinates for d1igd__.
(The format of our PDB-style files is described here.)

Timeline for d1igd__: