Lineage for d6ixlc_ (6ixl C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906360Species Ostreococcus tauri [TaxId:70448] [378192] (4 PDB entries)
  8. 2906363Domain d6ixlc_: 6ixl C: [378201]
    automated match to d2qfwd_
    complexed with gol, so4

Details for d6ixlc_

PDB Entry: 6ixl (more details), 1.75 Å

PDB Description: crystal structure of isocitrate dehydrogenase from ostreococcus tauri
PDB Compounds: (C:) isocitrate dehydrogenase

SCOPe Domain Sequences for d6ixlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ixlc_ c.77.1.0 (C:) automated matches {Ostreococcus tauri [TaxId: 70448]}
skitaapmvyvrgeemtayvmdlirsrwieprvdvggwetfdlraknrddtedrvlrdvi
eagkrikaifkeptvtptadqvkrlglrkswgspngamrrgwngitisrdtihidgvelg
ykkpvlferhavggeysagyknvgkgkltttftpsegpdagktvvvdereivdeeaavvt
yhnpydnvhdlarfffgrcleakvtpyvvtkktvfkwqepfwqimrtvfdeefkaqfvaa
gvmkegeelvhllsdaatmklvqwrqggfgmaahnydgdvltdelaqvhkspgfitsnlv
gvhedgtlikefeashgtvadmdearlrgeetslnplgmvegligamnhaadvhnidrdr
thafttkmrtvihqlfregkgtrdlcgpsgltteqfidavaerld

SCOPe Domain Coordinates for d6ixlc_:

Click to download the PDB-style file with coordinates for d6ixlc_.
(The format of our PDB-style files is described here.)

Timeline for d6ixlc_: